LRRC56 Antikörper (N-Term)

Produktnummer ABIN632776

Produktdetails anti-LRRC56 Antikörper

Target: LRRC56 (Leucine Rich Repeat Containing 56 (LRRC56))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LRRC56 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LRRC56 antibody was raised against the N terminal of LRRC56

Aufreinigung: Affinity purified

Immunogen: LRRC56 antibody was raised using the N terminal of LRRC56 corresponding to a region with amino acids LEMCVDTREGSLGNFGVHLPNLDQLKLNGSHLGSLRDLGTSLGHLQVLWL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LRRC56 Blocking Peptide, catalog no. 33R-4915, is also available for use as a blocking control in assays to test for specificity of this LRRC56 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC56 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LRRC56

Target: LRRC56 (Leucine Rich Repeat Containing 56 (LRRC56))

Andere Bezeichnung: LRRC56 (LRRC56 Produkte)

Synonyme: 5730427C23Rik antikoerper, BB110509 antikoerper, mFLJ00101 antikoerper, RGD1311654 antikoerper, leucine rich repeat containing 56 antikoerper, LRRC56 antikoerper, Lrrc56 antikoerper

Hintergrund: LRRC56 contains 3 LRR (leucine-rich) repeats. The exact function of LRRC56 remains unknown.

Molekulargewicht: 59 kDa (MW of target protein)