PGBD2 Antikörper (Middle Region)
-
- Target Alle PGBD2 Antikörper anzeigen
- PGBD2 (PiggyBac Transposable Element Derived 2 (PGBD2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PGBD2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PGBD2 antibody was raised against the middle region of PGBD2
- Aufreinigung
- Affinity purified
- Immunogen
- PGBD2 antibody was raised using the middle region of PGBD2 corresponding to a region with amino acids RICCQDAQVDLLAFRRYIACVYLESNADTTSQGRRSRRLETESRFDMIGH
- Top Product
- Discover our top product PGBD2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PGBD2 Blocking Peptide, catalog no. 33R-7960, is also available for use as a blocking control in assays to test for specificity of this PGBD2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGBD2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PGBD2 (PiggyBac Transposable Element Derived 2 (PGBD2))
- Andere Bezeichnung
- PGBD2 (PGBD2 Produkte)
- Synonyme
- piggyBac transposable element derived 2 antikoerper, PGBD2 antikoerper, Pgbd2 antikoerper
- Hintergrund
- The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. The exact function of this gene is not known.
- Molekulargewicht
- 39 kDa (MW of target protein)
-