CCDC7 Antikörper (N-Term)

Produktnummer ABIN632784

Produktdetails anti-CCDC7 Antikörper

Target: CCDC7 (Coiled-Coil Domain Containing 7 (CCDC7))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CCDC7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CCDC7 antibody was raised against the N terminal of CCDC7

Aufreinigung: Affinity purified

Immunogen: CCDC7 antibody was raised using the N terminal of CCDC7 corresponding to a region with amino acids KHNAKLIHDKIEPMVLRSPPTGESILRYALPIPSSKTKNLLPEDEMIGKI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CCDC7 Blocking Peptide, catalog no. 33R-4415, is also available for use as a blocking control in assays to test for specificity of this CCDC7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CCDC7

Target: CCDC7 (Coiled-Coil Domain Containing 7 (CCDC7))

Andere Bezeichnung: CCDC7 (CCDC7 Produkte)

Synonyme: dJ1104A8.1 antikoerper, 4930517G15Rik antikoerper, 4930540C21Rik antikoerper, Biot2 antikoerper, CCDC7 antikoerper, QtsA-13472 antikoerper, coiled-coil domain containing 7 antikoerper, coiled-coil domain containing 7A antikoerper, uncharacterized protein C10orf68 antikoerper, coiled-coil domain-containing protein 7 antikoerper, Coiled-coil domain-containing protein 7 antikoerper, CCDC7 antikoerper, Ccdc7a antikoerper, Ccdc7 antikoerper, LOC616662 antikoerper, LOC103350869 antikoerper, LOC100060704 antikoerper

Hintergrund: The function of CCDC7 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 56 kDa (MW of target protein)