SOHLH1 Antikörper (C-Term)

Produktnummer ABIN632790

Produktdetails anti-SOHLH1 Antikörper

Target: SOHLH1 (Spermatogenesis and Oogenesis Specific Basic Helix-Loop-Helix 1 (SOHLH1))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SOHLH1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SOHLH1 antibody was raised against the C terminal of SOHLH1

Aufreinigung: Affinity purified

Immunogen: SOHLH1 antibody was raised using the C terminal of SOHLH1 corresponding to a region with amino acids PAWAPAESSPLDVGEPGFLGDPELGSQELQDSPLEPWGLDVDCAGLALKD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SOHLH1 Blocking Peptide, catalog no. 33R-6990, is also available for use as a blocking control in assays to test for specificity of this SOHLH1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SOHLH1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SOHLH1

Target: SOHLH1 (Spermatogenesis and Oogenesis Specific Basic Helix-Loop-Helix 1 (SOHLH1))

Andere Bezeichnung: SOHLH1 (SOHLH1 Produkte)

Synonyme: C9orf157 antikoerper, NOHLH antikoerper, SPATA27 antikoerper, TEB2 antikoerper, bA100C15.3 antikoerper, bHLHe80 antikoerper, Gm110 antikoerper, Nohlh antikoerper, RGD1564440 antikoerper, spermatogenesis and oogenesis specific basic helix-loop-helix 1 antikoerper, SOHLH1 antikoerper, Sohlh1 antikoerper

Hintergrund: SOHLH1 contains 1 basic helix-loop-helix (bHLH) domain. It is a probable transcription factor required during spermatogenesis and oogenesis.

Molekulargewicht: 41 kDa (MW of target protein)