CHORDC1 Antikörper
-
- Target Alle CHORDC1 Antikörper anzeigen
- CHORDC1 (Cysteine and Histidine-Rich Domain (CHORD)-Containing 1 (CHORDC1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CHORDC1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- CHORDC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SGVPIFHEGMKYWSCCRRKTSDFNTFLAQEGCTKGKHMWTKKDAGKKVVP
- Top Product
- Discover our top product CHORDC1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CHORDC1 Blocking Peptide, catalog no. 33R-8501, is also available for use as a blocking control in assays to test for specificity of this CHORDC1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHORDC1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHORDC1 (Cysteine and Histidine-Rich Domain (CHORD)-Containing 1 (CHORDC1))
- Andere Bezeichnung
- CHORDC1 (CHORDC1 Produkte)
- Synonyme
- CHP1 antikoerper, CHP-1 antikoerper, MGC89160 antikoerper, NV16801 antikoerper, Chp-1 antikoerper, Morgana antikoerper, 1110001O09Rik antikoerper, AA409036 antikoerper, morgana antikoerper, zgc:63894 antikoerper, cysteine and histidine rich domain containing 1 antikoerper, cysteine and histidine-rich domain-containing protein antikoerper, cysteine and histidine rich domain containing 1 S homeolog antikoerper, cysteine and histidine-rich domain (CHORD)-containing 1 antikoerper, cysteine and histidine-rich domain (CHORD)-containing, zinc-binding protein 1 antikoerper, cysteine and histidine-rich domain (CHORD) containing 1b antikoerper, CHORDC1 antikoerper, Chordc1 antikoerper, LOC412067 antikoerper, chordc1.S antikoerper, chordc1 antikoerper, chordc1b antikoerper
- Hintergrund
- CHORDC1 may be play a role in the regulation of NOD1 via its interaction with HSP90AA1.
- Molekulargewicht
- 37 kDa (MW of target protein)
-