PTGR1 Antikörper (N-Term)
-
- Target Alle PTGR1 Antikörper anzeigen
- PTGR1 (Prostaglandin Reductase 1 (PTGR1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PTGR1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LTB4 DH antibody was raised against the N terminal Of Ltb4 h
- Aufreinigung
- Affinity purified
- Immunogen
- LTB4 DH antibody was raised using the N terminal Of Ltb4 h corresponding to a region with amino acids VRTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMR
- Top Product
- Discover our top product PTGR1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LTB4DH Blocking Peptide, catalog no. 33R-9791, is also available for use as a blocking control in assays to test for specificity of this LTB4DH antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LTB0 H antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PTGR1 (Prostaglandin Reductase 1 (PTGR1))
- Andere Bezeichnung
- LTB4DH (PTGR1 Produkte)
- Hintergrund
- LTB4DH functions as 15-oxo-prostaglandin 13-reductase and acts on 15-oxo-PGE1, 15-oxo-PGE2 and 15-oxo-PGE2-alpha. It has no activity towards PGE1, PGE2 and PGE2-alpha. LTB4DH catalyzes the conversion of leukotriene B4 into its biologically less active metabolite, 12-oxo-leukotriene B4. This is an initial and key step of metabolic inactivation of leukotriene B4.
- Molekulargewicht
- 36 kDa (MW of target protein)
-