R3HDM2 Antikörper (Middle Region)

Produktnummer ABIN632805

Produktdetails anti-R3HDM2 Antikörper

Target: R3HDM2 (R3H Domain Containing 2 (R3HDM2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser R3HDM2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: R3 HDM2 antibody was raised against the middle region of R3 DM2

Aufreinigung: Affinity purified

Immunogen: R3 HDM2 antibody was raised using the middle region of R3 DM2 corresponding to a region with amino acids QSTYTVHQGQSGLKHGNRGKRQALKSASTDLGTADVVLGRVLEVTDLPEG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

R3HDM2 Blocking Peptide, catalog no. 33R-7740, is also available for use as a blocking control in assays to test for specificity of this R3HDM2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of R0 DM2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu R3HDM2

Target: R3HDM2 (R3H Domain Containing 2 (R3HDM2))

Andere Bezeichnung: R3HDM2 (R3HDM2 Produkte)

Synonyme: PR01365 antikoerper, 1300003K24Rik antikoerper, AU041262 antikoerper, mKIAA1002 antikoerper, RGD1310066 antikoerper, R3H domain containing 2 antikoerper, R3HDM2 antikoerper, R3hdm2 antikoerper

Hintergrund: R3HDM2 contains 1 R3H domain. The function of R3HDM2 remains unknown.

Molekulargewicht: 68 kDa (MW of target protein)