R3HDM2 Antikörper (Middle Region)
-
- Target Alle R3HDM2 Produkte
- R3HDM2 (R3H Domain Containing 2 (R3HDM2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser R3HDM2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- R3 HDM2 antibody was raised against the middle region of R3 DM2
- Aufreinigung
- Affinity purified
- Immunogen
- R3 HDM2 antibody was raised using the middle region of R3 DM2 corresponding to a region with amino acids QSTYTVHQGQSGLKHGNRGKRQALKSASTDLGTADVVLGRVLEVTDLPEG
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
R3HDM2 Blocking Peptide, catalog no. 33R-7740, is also available for use as a blocking control in assays to test for specificity of this R3HDM2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of R0 DM2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- R3HDM2 (R3H Domain Containing 2 (R3HDM2))
- Andere Bezeichnung
- R3HDM2 (R3HDM2 Produkte)
- Synonyme
- PR01365 antikoerper, 1300003K24Rik antikoerper, AU041262 antikoerper, mKIAA1002 antikoerper, RGD1310066 antikoerper, R3H domain containing 2 antikoerper, R3HDM2 antikoerper, R3hdm2 antikoerper
- Hintergrund
- R3HDM2 contains 1 R3H domain. The function of R3HDM2 remains unknown.
- Molekulargewicht
- 68 kDa (MW of target protein)
-