PDXDC1 Antikörper (N-Term)

Produktnummer ABIN632806

Produktdetails anti-PDXDC1 Antikörper

Target: PDXDC1 (Pyridoxal-Dependent Decarboxylase Domain Containing 1 (PDXDC1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDXDC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PDXDC1 antibody was raised against the N terminal of PDXDC1

Aufreinigung: Affinity purified

Immunogen: PDXDC1 antibody was raised using the N terminal of PDXDC1 corresponding to a region with amino acids DEDEEPQSPRIQNIGEQGHMALLGHSLGAYISTLDKEKLRKLTTRILSDT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PDXDC1 Blocking Peptide, catalog no. 33R-1893, is also available for use as a blocking control in assays to test for specificity of this PDXDC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDXDC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PDXDC1

Target: PDXDC1 (Pyridoxal-Dependent Decarboxylase Domain Containing 1 (PDXDC1))

Andere Bezeichnung: PDXDC1 (PDXDC1 Produkte)

Hintergrund: PDXDC1 belongs to the group II decarboxylase family. The function of PDXDC1 remains unknown.

Molekulargewicht: 87 kDa (MW of target protein)