LSM14A Antikörper
-
- Target Alle LSM14A Antikörper anzeigen
- LSM14A (LSM14A, SCD6 Homolog A (LSM14A))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LSM14A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- LSM14 A antibody was raised using a synthetic peptide corresponding to a region with amino acids KLEKQEKPVNGEDKGDSGVDTQNSEGNADEEDPLGPNCYYDKTKSFFDNI
- Top Product
- Discover our top product LSM14A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LSM14A Blocking Peptide, catalog no. 33R-4505, is also available for use as a blocking control in assays to test for specificity of this LSM14A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LSM10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LSM14A (LSM14A, SCD6 Homolog A (LSM14A))
- Andere Bezeichnung
- LSM14A (LSM14A Produkte)
- Synonyme
- C19orf13 antikoerper, FAM61A antikoerper, RAP55 antikoerper, RAP55A antikoerper, 2700023B17Rik antikoerper, AA407828 antikoerper, AU017544 antikoerper, Tral antikoerper, RGD1305695 antikoerper, fam61a antikoerper, lsm14a antikoerper, wu:fj52e11 antikoerper, zgc:63681 antikoerper, zgc:66203 antikoerper, zgc:77302 antikoerper, rap55 antikoerper, RAP55A-A antikoerper, rap55a antikoerper, xRAP55 antikoerper, xRAP55A antikoerper, RAP55A-B antikoerper, wu:fc55d12 antikoerper, zgc:55754 antikoerper, zgc:77202 antikoerper, LSM14A, mRNA processing body assembly factor antikoerper, LSM14A mRNA processing body assembly factor antikoerper, LSM14A mRNA processing body assembly factor a antikoerper, LSM14A mRNA processing body assembly factor L homeolog antikoerper, LSM14A mRNA processing body assembly factor S homeolog antikoerper, LSM14A mRNA processing body assembly factor b antikoerper, LSM14A antikoerper, Lsm14a antikoerper, lsm14aa antikoerper, lsm14a antikoerper, lsm14a.L antikoerper, lsm14a.S antikoerper, lsm14ab antikoerper
- Hintergrund
- Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.
- Molekulargewicht
- 50 kDa (MW of target protein)
- Pathways
- Activation of Innate immune Response, Ribonucleoprotein Complex Subunit Organization
-