KRT18P55 Antikörper (N-Term)
-
- Target Alle KRT18P55 Produkte
- KRT18P55 (Keratin 18 Pseudogene 55 (KRT18P55))
- Bindungsspezifität
- N-Term
- Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KRT18P55 Antikörper ist unkonjugiert
- Applikation
- Western Blotting (WB)
- Spezifität
- FLJ40504 antibody was raised against the N terminal of FLJ40504
- Aufreinigung
- Affinity purified
- Immunogen
- FLJ40504 antibody was raised using the N terminal of FLJ40504 corresponding to a region with amino acids MDHCLISGLSQLDLPSALTKNWPSKPESCPLALLPGQHELHHLLHPLHQL
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FLJ40504 Blocking Peptide, catalog no. 33R-5837, is also available for use as a blocking control in assays to test for specificity of this FLJ40504 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ40504 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KRT18P55 (Keratin 18 Pseudogene 55 (KRT18P55))
- Andere Bezeichnung
- FLJ40504 (KRT18P55 Produkte)
- Hintergrund
- The specific function of FFLJ40504 is not yet known.
- Molekulargewicht
- 29 kDa (MW of target protein)
-