C5orf36 Antikörper (N-Term)

Produktnummer ABIN632837

Produktdetails anti-C5orf36 Antikörper

Target: C5orf36 (Chromosome 5 Open Reading Frame 36 (C5orf36))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C5orf36 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C5 ORF36 antibody was raised against the N terminal Of C5 rf36

Aufreinigung: Affinity purified

Immunogen: C5 ORF36 antibody was raised using the N terminal Of C5 rf36 corresponding to a region with amino acids CFEWLTNYNYSTSESSFISHGDLIKFFKTLQDLLKNEQNQEEMTLDLLWD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C5ORF36 Blocking Peptide, catalog no. 33R-1681, is also available for use as a blocking control in assays to test for specificity of this C5ORF36 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF36 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C5orf36

Target: C5orf36 (Chromosome 5 Open Reading Frame 36 (C5orf36))

Andere Bezeichnung: C5ORF36 (C5orf36 Produkte)

Synonyme: C5orf36 antikoerper, KIAA0825 antikoerper, KIAA0825 antikoerper

Hintergrund: The specific function of C5orf36 is not yet known.

Molekulargewicht: 37 kDa (MW of target protein)