HDDC3 Antikörper (Middle Region)
-
- Target Alle HDDC3 Antikörper anzeigen
- HDDC3 (HD Domain Containing 3 (HDDC3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HDDC3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- HDDC3 antibody was raised against the middle region of HDDC3
- Aufreinigung
- Affinity purified
- Immunogen
- HDDC3 antibody was raised using the middle region of HDDC3 corresponding to a region with amino acids TDDKTLPKLERKRLQVEQAPHSSPGAKLVKLADKLYNLRDLNRCTPEVKI
- Top Product
- Discover our top product HDDC3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HDDC3 Blocking Peptide, catalog no. 33R-9007, is also available for use as a blocking control in assays to test for specificity of this HDDC3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HDDC3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HDDC3 (HD Domain Containing 3 (HDDC3))
- Andere Bezeichnung
- HDDC3 (HDDC3 Produkte)
- Synonyme
- MESH1 antikoerper, zgc:110184 antikoerper, 1110033O09Rik antikoerper, C86475 antikoerper, RGD1311839 antikoerper, HD domain containing 3 antikoerper, HD domain containing 3 S homeolog antikoerper, hddc3 antikoerper, HDDC3 antikoerper, hddc3.S antikoerper, Hddc3 antikoerper
- Hintergrund
- The function of HDDC3 protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 16 kDa (MW of target protein)
-