C3orf62 Antikörper (Middle Region)

Produktnummer ABIN632849

Produktdetails anti-C3orf62 Antikörper

Target: C3orf62 (Chromosome 3 Open Reading Frame 62 (C3orf62))

Bindungsspezifität: Middle Region

Reaktivität: Maus, Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C3orf62 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C3 ORF62 antibody was raised against the middle region of C3 rf62

Aufreinigung: Affinity purified

Immunogen: C3 ORF62 antibody was raised using the middle region of C3 rf62 corresponding to a region with amino acids IDHTSIRTIEELAGKIEFENELNHMCGHCQDSPFKEEAWALLMDKSPQKA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C3ORF62 Blocking Peptide, catalog no. 33R-3915, is also available for use as a blocking control in assays to test for specificity of this C3ORF62 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF62 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C3orf62

Target: C3orf62 (Chromosome 3 Open Reading Frame 62 (C3orf62))

Andere Bezeichnung: C3ORF62 (C3orf62 Produkte)

Synonyme: chromosome 3 open reading frame 62 antikoerper, C3orf62 antikoerper

Hintergrund: The function of Chromosome 3 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 30 kDa (MW of target protein)