C17orf82 Antikörper (N-Term)

Produktnummer ABIN632856

Produktdetails anti-C17orf82 Antikörper

Target: C17orf82 (Chromosome 17 Open Reading Frame 82 (C17orf82))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C17orf82 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C17 ORF82 antibody was raised against the N terminal Of C17 rf82

Aufreinigung: Affinity purified

Immunogen: C17 ORF82 antibody was raised using the N terminal Of C17 rf82 corresponding to a region with amino acids MGRPLEGQPLRALDLYPEPAFLRSGKDPKSSPASSPSFAVLGPEVRSTGG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C17ORF82 Blocking Peptide, catalog no. 33R-6069, is also available for use as a blocking control in assays to test for specificity of this C17ORF82 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF82 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C17orf82

Target: C17orf82 (Chromosome 17 Open Reading Frame 82 (C17orf82))

Andere Bezeichnung: C17ORF82 (C17orf82 Produkte)

Synonyme: chromosome 17 open reading frame 82 antikoerper, C17orf82 antikoerper

Hintergrund: The function of Chromosome 17 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 25 kDa (MW of target protein)