FLJ35767 (Middle Region) Antikörper

Produktnummer ABIN632861

Produktdetails

Target: FLJ35767

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FLJ35767 antibody was raised against the middle region of FLJ35767

Aufreinigung: Affinity purified

Immunogen: FLJ35767 antibody was raised using the middle region of FLJ35767 corresponding to a region with amino acids PEGLEDAGLDPHFVPTELWPQEAVPLGLGLEDADWTQGLPWRFEELLTCS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FLJ35767 Blocking Peptide, catalog no. 33R-7042, is also available for use as a blocking control in assays to test for specificity of this FLJ35767 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ35767 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: FLJ35767

Hintergrund: The function of FLJ35767 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 18 kDa (MW of target protein)