MGC50273 (N-Term) Antikörper

Produktnummer ABIN632863

Produktdetails

Target: MGC50273

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MGC50273 antibody was raised against the N terminal of MGC50273

Aufreinigung: Affinity purified

Immunogen: MGC50273 antibody was raised using the N terminal of MGC50273 corresponding to a region with amino acids MFVRPESGEQGPETLAPASGAEIQRFPVPAVEPVPAPGADSPPGTALELE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MGC50273 Blocking Peptide, catalog no. 33R-6007, is also available for use as a blocking control in assays to test for specificity of this MGC50273 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC50273 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: MGC50273

Hintergrund: The function of MGC50273 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 22 kDa (MW of target protein)