C1orf103 Antikörper (N-Term)

Produktnummer ABIN632871

Produktdetails anti-C1orf103 Antikörper

Target: C1orf103 (Chromosome 1 Open Reading Frame 103 (C1orf103))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C1orf103 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C1 ORF103 antibody was raised against the N terminal Of C1 rf103

Aufreinigung: Affinity purified

Immunogen: C1 ORF103 antibody was raised using the N terminal Of C1 rf103 corresponding to a region with amino acids KKIFGLTKDLRVCLTRIPDHLTSGEGFDSFSSLVKSGTYKETEFMVKEGE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C1ORF103 Blocking Peptide, catalog no. 33R-4472, is also available for use as a blocking control in assays to test for specificity of this C1ORF103 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF103 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C1orf103

Target: C1orf103 (Chromosome 1 Open Reading Frame 103 (C1orf103))

Andere Bezeichnung: C1ORF103 (C1orf103 Produkte)

Synonyme: C1orf103 antikoerper, RIF1 antikoerper, RP11-96K19.1 antikoerper, 2010012G17Rik antikoerper, 4933421E11Rik antikoerper, AI450568 antikoerper, Rif1 antikoerper, RGD1306520 antikoerper, ligand dependent nuclear receptor interacting factor 1 antikoerper, LRIF1 antikoerper, Lrif1 antikoerper

Hintergrund: The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 27 kDa (MW of target protein)

Pathways: Nuclear Hormone Receptor Binding