PBLD1 Antikörper (N-Term)

Produktnummer ABIN632880

Produktdetails anti-PBLD1 Antikörper

Target: PBLD1 (Phenazine Biosynthesis-Like Protein Domain Containing 1 (PBLD1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PBLD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PBLD antibody was raised against the N terminal of PBLD

Aufreinigung: Affinity purified

Immunogen: PBLD antibody was raised using the N terminal of PBLD corresponding to a region with amino acids KLPIFIADAFTARAFRGNPAAVCLLENELDEDMHQKIAREMNLSETAFIR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PBLD Blocking Peptide, catalog no. 33R-4526, is also available for use as a blocking control in assays to test for specificity of this PBLD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PBLD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PBLD1

Target: PBLD1 (Phenazine Biosynthesis-Like Protein Domain Containing 1 (PBLD1))

Andere Bezeichnung: PBLD (PBLD1 Produkte)

Synonyme: MAWBP antikoerper, MAWDBP antikoerper, 0610038K03Rik antikoerper, Mawbp antikoerper, Pbld antikoerper, phenazine biosynthesis like protein domain containing antikoerper, phenazine biosynthesis-like protein domain containing 1 antikoerper, PBLD antikoerper, Pbld1 antikoerper

Hintergrund: The function of the PBLD protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 31 kDa (MW of target protein)