HMGCLL1 Antikörper (N-Term)

Produktnummer ABIN632887

Produktdetails anti-HMGCLL1 Antikörper

Target: HMGCLL1 (3-Hydroxymethyl-3-Methylglutaryl-CoA Lyase-Like 1 (HMGCLL1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HMGCLL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HMGCLL1 antibody was raised against the N terminal of HMGCLL1

Aufreinigung: Affinity purified

Immunogen: HMGCLL1 antibody was raised using the N terminal of HMGCLL1 corresponding to a region with amino acids MGNVPSAVKHCLSYQQLLREHLWIGDSVAGALDPAQETSQLSGLPEFVKI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HMGCLL1 Blocking Peptide, catalog no. 33R-6052, is also available for use as a blocking control in assays to test for specificity of this HMGCLL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HMGCLL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HMGCLL1

Target: HMGCLL1 (3-Hydroxymethyl-3-Methylglutaryl-CoA Lyase-Like 1 (HMGCLL1))

Andere Bezeichnung: HMGCLL1 (HMGCLL1 Produkte)

Synonyme: bA418P12.1 antikoerper, er-cHL antikoerper, RGD1565090 antikoerper, zgc:172206 antikoerper, BC037381 antikoerper, 3-hydroxymethyl-3-methylglutaryl-CoA lyase like 1 antikoerper, 3-hydroxymethyl-3-methylglutaryl-CoA lyase-like 1 antikoerper, 3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase-like 1 antikoerper, HMGCLL1 antikoerper, Hmgcll1 antikoerper, hmgcll1 antikoerper

Hintergrund: HMGCLL1 is involved in the catabolism of branched amino acids such as leucine.

Molekulargewicht: 36 kDa (MW of target protein)