TBC1D14 Antikörper (N-Term)

Produktnummer ABIN632891

Produktdetails anti-TBC1D14 Antikörper

Target: TBC1D14 (TBC1 Domain Family, Member 14 (TBC1D14))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TBC1D14 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TBC1 D14 antibody was raised against the N terminal of TBC1 14

Aufreinigung: Affinity purified

Immunogen: TBC1 D14 antibody was raised using the N terminal of TBC1 14 corresponding to a region with amino acids MTDGKLSTSTNGVAFMGILDGRPGNPLQNLQHVNLKAPRLLSAPEYGPKL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TBC1D14 Blocking Peptide, catalog no. 33R-6536, is also available for use as a blocking control in assays to test for specificity of this TBC1D14 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 14 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TBC1D14

Target: TBC1D14 (TBC1 Domain Family, Member 14 (TBC1D14))

Andere Bezeichnung: TBC1D14 (TBC1D14 Produkte)

Synonyme: fi35h01 antikoerper, si:dkey-120m5.1 antikoerper, wu:fi35h01 antikoerper, wu:fi42a03 antikoerper, DKFZp469A1818 antikoerper, 2810413P16Rik antikoerper, AU043625 antikoerper, C86258 antikoerper, D5Ertd110e antikoerper, mKIAA1322 antikoerper, SRF-2 antikoerper, TBC1 domain family member 14 antikoerper, TBC1 domain family, member 14 antikoerper, TBC1 domain family member 14 L homeolog antikoerper, TBC1D14 antikoerper, tbc1d14 antikoerper, tbc1d14.L antikoerper, Tbc1d14 antikoerper

Hintergrund: TBC1D14 may act as a GTPase-activating protein for Rab family proteins.

Molekulargewicht: 76 kDa (MW of target protein)