TBC1D25 Antikörper (N-Term)
-
- Target Alle TBC1D25 Antikörper anzeigen
- TBC1D25 (TBC1 Domain Family, Member 25 (TBC1D25))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TBC1D25 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TBC1 D25 antibody was raised against the N terminal of TBC1 25
- Aufreinigung
- Affinity purified
- Immunogen
- TBC1 D25 antibody was raised using the N terminal of TBC1 25 corresponding to a region with amino acids KVQQVLSWSYGEDVKPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGG
- Top Product
- Discover our top product TBC1D25 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TBC1D25 Blocking Peptide, catalog no. 33R-4721, is also available for use as a blocking control in assays to test for specificity of this TBC1D25 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 25 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TBC1D25 (TBC1 Domain Family, Member 25 (TBC1D25))
- Andere Bezeichnung
- TBC1D25 (TBC1D25 Produkte)
- Hintergrund
- This gene encodes a protein with a TBC domain and may function as a Rab GTPase activating protein. This gene was previously known as ornithine aminotransferase-like 1, but has no similarity to ornithine aminotransferase.
- Molekulargewicht
- 76 kDa (MW of target protein)
-