C22orf28 Antikörper (N-Term)

Produktnummer ABIN632911

Produktdetails anti-C22orf28 Antikörper

Target: C22orf28 (Chromosome 22 Open Reading Frame 28 (C22orf28))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C22orf28 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C22 ORF28 antibody was raised against the N terminal Of C22 rf28

Aufreinigung: Affinity purified

Immunogen: C22 ORF28 antibody was raised using the N terminal Of C22 rf28 corresponding to a region with amino acids PEAVVSPGGVGFDINCGVRLLRTNLDESDVQPVKEQLAQAMFDHIPVGVG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C22ORF28 Blocking Peptide, catalog no. 33R-7033, is also available for use as a blocking control in assays to test for specificity of this C22ORF28 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF28 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C22orf28

Target: C22orf28 (Chromosome 22 Open Reading Frame 28 (C22orf28))

Andere Bezeichnung: C22ORF28 (C22orf28 Produkte)

Synonyme: C1H22orf28 antikoerper, C22orf28 antikoerper, DJ149A16.6 antikoerper, FAAP antikoerper, RP1-149A16.6 antikoerper, c22orf28 antikoerper, C10H22orf28 antikoerper, MGC154502 antikoerper, HSPC117 antikoerper, AI255213 antikoerper, AI463255 antikoerper, RNA 2',3'-cyclic phosphate and 5'-OH ligase antikoerper, tRNA-splicing ligase RtcB homolog antikoerper, RTCB antikoerper, rtcb antikoerper, rtcb.L antikoerper, Rtcb antikoerper

Hintergrund: C22ORF28 is believed to be involved in vinculin binding.

Molekulargewicht: 55 kDa (MW of target protein)