C22orf28 Antikörper (N-Term)
-
- Target Alle C22orf28 Antikörper anzeigen
- C22orf28 (Chromosome 22 Open Reading Frame 28 (C22orf28))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser C22orf28 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C22 ORF28 antibody was raised against the N terminal Of C22 rf28
- Aufreinigung
- Affinity purified
- Immunogen
- C22 ORF28 antibody was raised using the N terminal Of C22 rf28 corresponding to a region with amino acids PEAVVSPGGVGFDINCGVRLLRTNLDESDVQPVKEQLAQAMFDHIPVGVG
- Top Product
- Discover our top product C22orf28 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C22ORF28 Blocking Peptide, catalog no. 33R-7033, is also available for use as a blocking control in assays to test for specificity of this C22ORF28 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF28 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C22orf28 (Chromosome 22 Open Reading Frame 28 (C22orf28))
- Andere Bezeichnung
- C22ORF28 (C22orf28 Produkte)
- Hintergrund
- C22ORF28 is believed to be involved in vinculin binding.
- Molekulargewicht
- 55 kDa (MW of target protein)
-