RPS27L Antikörper (N-Term)
-
- Target Alle RPS27L Antikörper anzeigen
- RPS27L (Ribosomal Protein S27L (RPS27L))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RPS27L Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RPS27 L antibody was raised against the N terminal of RPS27
- Aufreinigung
- Affinity purified
- Immunogen
- RPS27 L antibody was raised using the N terminal of RPS27 corresponding to a region with amino acids MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHA
- Top Product
- Discover our top product RPS27L Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RPS27L Blocking Peptide, catalog no. 33R-6290, is also available for use as a blocking control in assays to test for specificity of this RPS27L antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS20 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPS27L (Ribosomal Protein S27L (RPS27L))
- Andere Bezeichnung
- RPS27L (RPS27L Produkte)
- Hintergrund
- This gene encodes a protein sharing 96% amino acid similarity with ribosomal protein S27, which suggests the encoded protein may be a component of the 40S ribosomal subunit.
- Molekulargewicht
- 9 kDa (MW of target protein)
- Pathways
- Positive Regulation of Endopeptidase Activity
-