RPS27L Antikörper (N-Term)

Produktnummer ABIN632914

Produktdetails anti-RPS27L Antikörper

Target: RPS27L (Ribosomal Protein S27L (RPS27L))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPS27L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RPS27 L antibody was raised against the N terminal of RPS27

Aufreinigung: Affinity purified

Immunogen: RPS27 L antibody was raised using the N terminal of RPS27 corresponding to a region with amino acids MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPS27L Blocking Peptide, catalog no. 33R-6290, is also available for use as a blocking control in assays to test for specificity of this RPS27L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS20 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPS27L

Target: RPS27L (Ribosomal Protein S27L (RPS27L))

Andere Bezeichnung: RPS27L (RPS27L Produkte)

Synonyme: 1810034D23Rik antikoerper, ribosomal protein S27 like antikoerper, ribosomal protein S27-like antikoerper, RPS27L antikoerper, Rps27l antikoerper

Hintergrund: This gene encodes a protein sharing 96% amino acid similarity with ribosomal protein S27, which suggests the encoded protein may be a component of the 40S ribosomal subunit.

Molekulargewicht: 9 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity