RWDD1 Antikörper (Middle Region)
-
- Target Alle RWDD1 Antikörper anzeigen
- RWDD1 (RWD Domain Containing 1 (RWDD1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RWDD1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RWDD1 antibody was raised against the middle region of RWDD1
- Aufreinigung
- Affinity purified
- Immunogen
- RWDD1 antibody was raised using the middle region of RWDD1 corresponding to a region with amino acids KKRMKEEEQAGKNKLSGKQLFETDHNLDTSDIQFLEDAGNNVEVDESLFQ
- Top Product
- Discover our top product RWDD1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RWDD1 Blocking Peptide, catalog no. 33R-4491, is also available for use as a blocking control in assays to test for specificity of this RWDD1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RWDD1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RWDD1 (RWD Domain Containing 1 (RWDD1))
- Andere Bezeichnung
- RWDD1 (RWDD1 Produkte)
- Synonyme
- PTD013 antikoerper, 0710001K08Rik antikoerper, 2610002D06Rik antikoerper, 2700069A07Rik antikoerper, IH1 antikoerper, sarip antikoerper, RWD domain containing 1 antikoerper, RWDD1 antikoerper, Rwdd1 antikoerper
- Hintergrund
- The RWDD1 protein protects DRG2 from proteolytic degradation.
- Molekulargewicht
- 17 kDa (MW of target protein)
-