C20orf111 Antikörper (N-Term)
C20orf111
Reaktivität: Human, Maus, Ratte
WB
Wirt: Kaninchen
Polyclonal
unconjugated
1 image
-
- Target Alle C20orf111 Produkte
- C20orf111 (Chromosome 20 Open Reading Frame 111 (C20orf111))
- Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser C20orf111 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C20 ORF111 antibody was raised against the N terminal Of C20 rf111
- Aufreinigung
- Affinity purified
- Immunogen
- C20 ORF111 antibody was raised using the N terminal Of C20 rf111 corresponding to a region with amino acids RGAVRTQRRRRSKSPVLHPPKFIHCSTIASSSSSQLKHKSQTDSPDGSSG
-
anti-Chromosome 20 Open Reading Frame 111 (C20orf111) (N-Term) antibody
C20orf111 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen, Zebrafisch (Danio rerio) WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C20ORF111 Blocking Peptide, catalog no. 33R-7916, is also available for use as a blocking control in assays to test for specificity of this C20ORF111 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF111 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C20orf111 (Chromosome 20 Open Reading Frame 111 (C20orf111))
- Andere Bezeichnung
- C20ORF111 (C20orf111 Produkte)
- Synonyme
- MGC76290 antikoerper, DKFZp468B2423 antikoerper, C20orf111 antikoerper, MGC134505 antikoerper, c20orf111 antikoerper, HSPC207 antikoerper, Osr1 antikoerper, Perit1 antikoerper, dJ1183I21.1 antikoerper, oxidative stress responsive serine-rich 1 antikoerper, oxidative stress responsive serine rich 1 antikoerper, oxidative stress responsive serine-rich 1 L homeolog antikoerper, oser1 antikoerper, OSER1 antikoerper, oser1.L antikoerper
- Hintergrund
- The function of Chromosome 20 ORF protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 32 kDa (MW of target protein)
-
Sie sind hier:
