CXorf26 Antikörper (Middle Region)

Produktnummer ABIN632923

Produktdetails anti-CXorf26 Antikörper

Target: CXorf26 (Chromosome X Open Reading Frame 26 (CXorf26))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CXorf26 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CXORF26 antibody was raised against the middle region of Cxorf26

Aufreinigung: Affinity purified

Immunogen: CXORF26 antibody was raised using the middle region of Cxorf26 corresponding to a region with amino acids IYSEFRKNFETLRIDVLDPEELKSESAKEKWRPFCLKFNGIVEDFNYGTL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CXORF26 Blocking Peptide, catalog no. 33R-4226, is also available for use as a blocking control in assays to test for specificity of this CXORF26 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CXORF26 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CXorf26

Target: CXorf26 (Chromosome X Open Reading Frame 26 (CXorf26))

Andere Bezeichnung: CXORF26 (CXorf26 Produkte)

Synonyme: CXorf26 antikoerper, MGC86379 antikoerper, CXHXorf26 antikoerper, 2610029G23Rik antikoerper, cb679 antikoerper, fc12c03 antikoerper, sb:cb679 antikoerper, wu:fc12c03 antikoerper, zgc:92611 antikoerper, RGD1562502 antikoerper, polysaccharide biosynthesis domain containing 1 antikoerper, polysaccharide biosynthesis domain containing 1 S homeolog antikoerper, PBDC1 antikoerper, pbdc1.S antikoerper, pbdc1 antikoerper, Pbdc1 antikoerper

Hintergrund: The function of Chromosome X ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 26 kDa (MW of target protein)