CHCHD3 Antikörper (N-Term)

Produktnummer ABIN632928

Produktdetails anti-CHCHD3 Antikörper

Target: CHCHD3 (Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 3 (CHCHD3))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHCHD3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CHCHD3 antibody was raised against the N terminal of CHCHD3

Aufreinigung: Affinity purified

Immunogen: CHCHD3 antibody was raised using the N terminal of CHCHD3 corresponding to a region with amino acids RMKESSPSGSKSQRYSGAYGASVSDEELKRRVAEELALEQAKKESEDQKR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHCHD3 Blocking Peptide, catalog no. 33R-8063, is also available for use as a blocking control in assays to test for specificity of this CHCHD3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHCHD3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHCHD3

Target: CHCHD3 (Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 3 (CHCHD3))

Andere Bezeichnung: CHCHD3 (CHCHD3 Produkte)

Synonyme: MINOS3 antikoerper, PPP1R22 antikoerper, 0610041L09Rik antikoerper, 1700039J09Rik antikoerper, AW558177 antikoerper, plxna4 antikoerper, FLJ20420 antikoerper, wu:fe23h05 antikoerper, zgc:111837 antikoerper, si:rp71-18a24.1 antikoerper, MGC80265 antikoerper, MGC88973 antikoerper, coiled-coil-helix-coiled-coil-helix domain containing 3 antikoerper, coiled-coil-helix-coiled-coil-helix domain containing 3a antikoerper, coiled-coil-helix-coiled-coil-helix domain containing 3 L homeolog antikoerper, CHCHD3 antikoerper, Chchd3 antikoerper, chchd3a antikoerper, chchd3.L antikoerper, chchd3 antikoerper, LOC100229580 antikoerper

Hintergrund: ChChd3 is an inner mitochondrial membrane protein and is essential for maintaining crista integrity and mitochondrial function.

Molekulargewicht: 26 kDa (MW of target protein)