RMND1 Antikörper

Produktnummer ABIN632930

Produktdetails anti-RMND1 Antikörper

Target: RMND1 (Required For Meiotic Nuclear Division 1 Homolog (RMND1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RMND1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: RMND1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEKHEIQPYEIALVHWENEELNYIKIEGQSKLHRGEIKLNSELDLDDAIL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RMND1 Blocking Peptide, catalog no. 33R-4909, is also available for use as a blocking control in assays to test for specificity of this RMND1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RMND1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RMND1

Target: RMND1 (Required For Meiotic Nuclear Division 1 Homolog (RMND1))

Andere Bezeichnung: RMND1 (RMND1 Produkte)

Synonyme: zgc:113022 antikoerper, DKFZp469I1433 antikoerper, C6orf96 antikoerper, COXPD11 antikoerper, RMD1 antikoerper, bA351K16 antikoerper, bA351K16.3 antikoerper, 0610042C05Rik antikoerper, AA408137 antikoerper, AI462664 antikoerper, AW536662 antikoerper, Iag-1 antikoerper, RGD1309546 antikoerper, required for meiotic nuclear division 1 homolog antikoerper, RMND1 antikoerper, rmnd1 antikoerper, Rmnd1 antikoerper

Hintergrund: The function of RMND1 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 51 kDa (MW of target protein)