MAP7D1 Antikörper (N-Term)
-
- Target Alle MAP7D1 Antikörper anzeigen
- MAP7D1 (MAP7 Domain Containing 1 (MAP7D1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MAP7D1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MAP7 D1 antibody was raised against the N terminal of MAP7 1
- Aufreinigung
- Affinity purified
- Immunogen
- MAP7 D1 antibody was raised using the N terminal of MAP7 1 corresponding to a region with amino acids RRRLEEQRLKAEQRRAALEERQRQKLEKNKERYEAAIQRSVKKTWAEIRQ
- Top Product
- Discover our top product MAP7D1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MAP7D1 Blocking Peptide, catalog no. 33R-8156, is also available for use as a blocking control in assays to test for specificity of this MAP7D1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAP7D1 (MAP7 Domain Containing 1 (MAP7D1))
- Andere Bezeichnung
- MAP7D1 (MAP7D1 Produkte)
- Synonyme
- PARCC1 antikoerper, RPRC1 antikoerper, Mtap7d1 antikoerper, AV028413 antikoerper, BC019977 antikoerper, Parcc1 antikoerper, Rprc1 antikoerper, mKIAA1187 antikoerper, zgc:172238 antikoerper, MAP7 domain containing 1 antikoerper, MAP7 domain containing 1b antikoerper, MAP7D1 antikoerper, Map7d1 antikoerper, map7d1b antikoerper
- Hintergrund
- The function of MAP7 protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 93 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interaktom, Phosphorylierungen bei SARS-CoV-2 Infektion
-