FAM90A1 Antikörper (N-Term)

Produktnummer ABIN632936

Produktdetails anti-FAM90A1 Antikörper

Target: FAM90A1 (Family with Sequence Similarity 90, Member A1 (FAM90A1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM90A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FAM90 A1 antibody was raised against the N terminal of FAM90 1

Aufreinigung: Affinity purified

Immunogen: FAM90 A1 antibody was raised using the N terminal of FAM90 1 corresponding to a region with amino acids PDEEDPRLKCKNCEAFGHTARSTRCPMKCWKAALVPPNFGEKEGKENLKP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM90A1 Blocking Peptide, catalog no. 33R-7006, is also available for use as a blocking control in assays to test for specificity of this FAM90A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM90 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM90A1

Target: FAM90A1 (Family with Sequence Similarity 90, Member A1 (FAM90A1))

Andere Bezeichnung: FAM90A1 (FAM90A1 Produkte)

Synonyme: family with sequence similarity 90 member A1 antikoerper, FAM90A1 antikoerper

Hintergrund: FAM90A1 belongs to subfamily I of the primate-specific FAM90A gene family, which originated from multiple duplications and rearrangements.

Molekulargewicht: 50 kDa (MW of target protein)