DNAAF2 Antikörper (N-Term)

Produktnummer ABIN632937

Produktdetails anti-DNAAF2 Antikörper

Target: DNAAF2 (C14orf104) (Chromosome 14 Open Reading Frame 104 (C14orf104))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DNAAF2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C14 ORF104 antibody was raised against the N terminal Of C14 rf104

Aufreinigung: Affinity purified

Immunogen: C14 ORF104 antibody was raised using the N terminal Of C14 rf104 corresponding to a region with amino acids MFSQYAEELTDPENRRRYEAEITALERERGVEVRFVHPEPGHVLRTSLDG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C14ORF104 Blocking Peptide, catalog no. 33R-6005, is also available for use as a blocking control in assays to test for specificity of this C14ORF104 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF104 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DNAAF2

Target: DNAAF2 (C14orf104) (Chromosome 14 Open Reading Frame 104 (C14orf104))

Andere Bezeichnung: C14ORF104 (C14orf104 Produkte)

Synonyme: 1110034A24Rik antikoerper, 2810020C19Rik antikoerper, AV032410 antikoerper, Ktu antikoerper, TU54 antikoerper, mknt antikoerper, C14orf104 antikoerper, CILD10 antikoerper, KTU antikoerper, PF13 antikoerper, C10H14orf104 antikoerper, RGD1310311 antikoerper, c14orf104 antikoerper, cild10 antikoerper, kintoun antikoerper, ktu antikoerper, zgc:110294 antikoerper, dynein axonemal assembly factor 2 antikoerper, dynein, axonemal assembly factor 2 antikoerper, dynein, axonemal, assembly factor 2 antikoerper, dynein, axonemal, assembly factor 2 L homeolog antikoerper, DNAAF2 antikoerper, Dnaaf2 antikoerper, dnaaf2.L antikoerper, dnaaf2 antikoerper

Hintergrund: This protein is highly conserved and involved in the preassembly of dynein arm complexes which power cilia. These complexes are found in some cilia and are assembled in the cytoplasm prior to transport for cilia formation. Mutations in this gene have been associated with primary ciliary dyskinesia. Multiple transcript variants encoding different isoforms have been found for this gene.

Molekulargewicht: 91 kDa (MW of target protein)