SASH3 Antikörper (N-Term)
-
- Target Alle SASH3 Antikörper anzeigen
- SASH3 (SAM and SH3 Domain Containing 3 (SASH3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SASH3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CXORF9 antibody was raised against the N terminal Of Cxorf9
- Aufreinigung
- Affinity purified
- Immunogen
- CXORF9 antibody was raised using the N terminal Of Cxorf9 corresponding to a region with amino acids KPSSPVVSEKEFNLDDNIPEDDSGVPTPEDAGKSGKKLGKKWRAVISRTM
- Top Product
- Discover our top product SASH3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CXORF9 Blocking Peptide, catalog no. 33R-4594, is also available for use as a blocking control in assays to test for specificity of this CXORF9 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CXORF9 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SASH3 (SAM and SH3 Domain Containing 3 (SASH3))
- Andere Bezeichnung
- CXORF9 (SASH3 Produkte)
- Hintergrund
- The CXORF9 protein contains a Src homology-3 (SH3) domain and a sterile alpha motif (SAM), both of which are found in proteins involved in cell signaling. This protein may function as a signaling adapter protein in lymphocytes.
- Molekulargewicht
- 41 kDa (MW of target protein)
- Pathways
- Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response
-