RAB22A Antikörper (Middle Region)
-
- Target Alle RAB22A Antikörper anzeigen
- RAB22A (RAB22A, Member RAS Oncogene Family (RAB22A))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RAB22A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RAB22 A antibody was raised against the middle region of RAB22
- Aufreinigung
- Affinity purified
- Immunogen
- RAB22 A antibody was raised using the middle region of RAB22 corresponding to a region with amino acids IFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRS
- Top Product
- Discover our top product RAB22A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RAB22A Blocking Peptide, catalog no. 33R-3964, is also available for use as a blocking control in assays to test for specificity of this RAB22A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB20 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RAB22A (RAB22A, Member RAS Oncogene Family (RAB22A))
- Andere Bezeichnung
- RAB22A (RAB22A Produkte)
- Synonyme
- 3732413A17Rik antikoerper, AI662177 antikoerper, AW319644 antikoerper, AW550514 antikoerper, E130120E14Rik antikoerper, Rab22 antikoerper, RAB22 antikoerper, RAB22A, member RAS oncogene family antikoerper, Rab22a antikoerper, RAB22A antikoerper
- Hintergrund
- The protein encoded by this gene is a member of the RAB family of small GTPases. The GTP-bound form of the encoded protein has been shown to interact with early-endosomal antigen 1, and may be involved in the trafficking of and interaction between endosom
- Molekulargewicht
- 22 kDa (MW of target protein)
-