KCTD16 Antikörper (N-Term)
-
- Target Alle KCTD16 Antikörper anzeigen
- KCTD16 (Potassium Channel Tetramerisation Domain Containing 16 (KCTD16))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KCTD16 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KCTD16 antibody was raised against the N terminal of KCTD16
- Aufreinigung
- Affinity purified
- Immunogen
- KCTD16 antibody was raised using the N terminal of KCTD16 corresponding to a region with amino acids KREAEYFQLPDLVKLLTPDEIKQSPDEFCHSDFEDASQGSDTRICPPSSL
- Top Product
- Discover our top product KCTD16 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KCTD16 Blocking Peptide, catalog no. 33R-4622, is also available for use as a blocking control in assays to test for specificity of this KCTD16 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD16 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCTD16 (Potassium Channel Tetramerisation Domain Containing 16 (KCTD16))
- Andere Bezeichnung
- KCTD16 (KCTD16 Produkte)
- Synonyme
- RGD1559856 antikoerper, 4930434H12Rik antikoerper, Gm1267 antikoerper, lrl1 antikoerper, lrl3 antikoerper, potassium channel tetramerization domain containing 16 antikoerper, potassium channel tetramerisation domain containing 16 antikoerper, potassium channel tetramerization domain containing 16a antikoerper, potassium channel tetramerization domain containing 16b antikoerper, Kctd16 antikoerper, KCTD16 antikoerper, kctd16 antikoerper, kctd16a antikoerper, kctd16b antikoerper
- Hintergrund
- KCTD16 is an auxiliary subunit of GABA-B receptors that determine the pharmacology and kinetics of the receptor response. The protein increases agonist potency and markedly alters the G-protein signaling of the receptors by accelerating onset and promoting desensitization.
- Molekulargewicht
- 49 kDa (MW of target protein)
- Pathways
- Synaptic Membrane, Regulation of G-Protein Coupled Receptor Protein Signaling
-