MAGEB1 Antikörper (Middle Region)

Produktnummer ABIN632955

Produktdetails anti-MAGEB1 Antikörper

Target: MAGEB1 (Melanoma Antigen Family B, 1 (MAGEB1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAGEB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MAGEB1 antibody was raised against the middle region of MAGEB1

Aufreinigung: Affinity purified

Immunogen: MAGEB1 antibody was raised using the middle region of MAGEB1 corresponding to a region with amino acids EFLAKMNGATPRDFPSHYEEALRDEEERAQVRSSVRARRRTTATTFRARS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAGEB1 Blocking Peptide, catalog no. 33R-2406, is also available for use as a blocking control in assays to test for specificity of this MAGEB1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAGEB1

Target: MAGEB1 (Melanoma Antigen Family B, 1 (MAGEB1))

Andere Bezeichnung: MAGEB1 (MAGEB1 Produkte)

Synonyme: CT3.1 antikoerper, DAM10 antikoerper, MAGE-Xp antikoerper, MAGEL1 antikoerper, MAGEB1 antikoerper, Mage-b1 antikoerper, Mage-rs1 antikoerper, Magel1 antikoerper, Smage1 antikoerper, dam1 antikoerper, MAGE family member B1 antikoerper, melanoma-associated antigen B1 antikoerper, melanoma antigen, family B, 1 antikoerper, melanoma antigen family B, 1 antikoerper, MAGEB1 antikoerper, LOC491803 antikoerper, Mageb1 antikoerper

Hintergrund: This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other.

Molekulargewicht: 39 kDa (MW of target protein)