BTF3P13 Antikörper (Middle Region)

Produktnummer ABIN632957

Produktdetails anti-BTF3P13 Antikörper

Target: BTF3P13 (Basic Transcription Factor 3 Pseudogene 13 (BTF3P13))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BTF3P13 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: BTF3 L3 antibody was raised against the middle region of BTF3 3

Aufreinigung: Affinity purified

Immunogen: BTF3 L3 antibody was raised using the middle region of BTF3 3 corresponding to a region with amino acids CRSTDHEPGKLAKLQAQVRIGGKGTAHRKKKVFHRTATADDKKLQFSLKK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BTF3L3 Blocking Peptide, catalog no. 33R-1800, is also available for use as a blocking control in assays to test for specificity of this BTF3L3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BTF0 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BTF3P13

Target: BTF3P13 (Basic Transcription Factor 3 Pseudogene 13 (BTF3P13))

Andere Bezeichnung: BTF3L3 (BTF3P13 Produkte)

Synonyme: BTF3L3 antikoerper, HUMBTFD antikoerper, basic transcription factor 3 pseudogene 13 antikoerper, BTF3P13 antikoerper

Hintergrund: BTF3L3 is a putative member of the BTF3 family of transcription factors and is thought to represent a pseudogene.

Molekulargewicht: 23 kDa (MW of target protein)