SNAP47 Antikörper (Middle Region)
-
- Target Alle SNAP47 Antikörper anzeigen
- SNAP47 (Synaptosomal-Associated Protein, 47kDa (SNAP47))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SNAP47 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C1 ORF142 antibody was raised against the middle region of C1 rf142
- Aufreinigung
- Affinity purified
- Immunogen
- C1 ORF142 antibody was raised using the middle region of C1 rf142 corresponding to a region with amino acids TALHLQTSLPALSEADTQELTQILRRMKGLALEAESELERQDEALDGVAA
- Top Product
- Discover our top product SNAP47 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C1ORF142 Blocking Peptide, catalog no. 33R-8979, is also available for use as a blocking control in assays to test for specificity of this C1ORF142 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF142 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SNAP47 (Synaptosomal-Associated Protein, 47kDa (SNAP47))
- Andere Bezeichnung
- C1ORF142 (SNAP47 Produkte)
- Synonyme
- 1110031B06Rik antikoerper, SNAP-47 antikoerper, RGD735194 antikoerper, zgc:153222 antikoerper, C1orf142 antikoerper, HEL170 antikoerper, SVAP1 antikoerper, C7H1orf142 antikoerper, synaptosome associated protein 47 antikoerper, synaptosome associated protein 47kDa L homeolog antikoerper, synaptosome associated protein 47kDa antikoerper, synaptosomal-associated protein, 47 antikoerper, SNAP47 antikoerper, snap47.L antikoerper, snap47 antikoerper, Snap47 antikoerper
- Hintergrund
- The C1ORF142 protein may play a role in intracellular membrane fusion.
- Molekulargewicht
- 51 kDa (MW of target protein)
-