CCDC74A Antikörper (Middle Region)

Produktnummer ABIN632959

Produktdetails anti-CCDC74A Antikörper

Target: CCDC74A (Coiled-Coil Domain Containing 74A (CCDC74A))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CCDC74A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CCDC74 A antibody was raised against the middle region of CCDC74

Aufreinigung: Affinity purified

Immunogen: CCDC74 A antibody was raised using the middle region of CCDC74 corresponding to a region with amino acids FPKVSTKSLSKKCLSPPVAERAILPALKQTPKNNFAERQKRLQAMQKRRL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CCDC74A Blocking Peptide, catalog no. 33R-3020, is also available for use as a blocking control in assays to test for specificity of this CCDC74A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC70 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CCDC74A

Target: CCDC74A (Coiled-Coil Domain Containing 74A (CCDC74A))

Andere Bezeichnung: CCDC74A (CCDC74A Produkte)

Synonyme: 2310015A05Rik antikoerper, coiled-coil domain containing 74A antikoerper, CCDC74A antikoerper, Ccdc74a antikoerper

Hintergrund: The function of CCDC74A protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 42 kDa (MW of target protein)