SCRN2 Antikörper (N-Term)

Produktnummer ABIN632961

Produktdetails anti-SCRN2 Antikörper

Target: SCRN2 (Secernin 2 (SCRN2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SCRN2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Secernin 2 antibody was raised against the N terminal of SCRN2

Aufreinigung: Affinity purified

Immunogen: Secernin 2 antibody was raised using the N terminal of SCRN2 corresponding to a region with amino acids MASSSPDSPCSCDCFVSVPPASAIPAVIFAKNSDRPRDEVQEVVFVPAGT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Secernin 2 Blocking Peptide, catalog no. 33R-5762, is also available for use as a blocking control in assays to test for specificity of this Secernin 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCRN2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SCRN2

Target: SCRN2 (Secernin 2 (SCRN2))

Andere Bezeichnung: Secernin 2 (SCRN2 Produkte)

Synonyme: MGC147610 antikoerper, si:ch211-184m19.2 antikoerper, Ses2 antikoerper, AV001119 antikoerper, D11Moh48 antikoerper, SES2 antikoerper, secernin 2 antikoerper, secernin 2 S homeolog antikoerper, SCRN2 antikoerper, scrn2 antikoerper, scrn2.S antikoerper, Scrn2 antikoerper

Hintergrund: The function of SCRN2 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 47 kDa (MW of target protein)