HYLS1 Antikörper (Middle Region)
-
- Target Alle HYLS1 Antikörper anzeigen
- HYLS1 (Hydrolethalus Syndrome 1 (HYLS1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HYLS1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- HYLS1 antibody was raised against the middle region of HYLS1
- Aufreinigung
- Affinity purified
- Immunogen
- HYLS1 antibody was raised using the middle region of HYLS1 corresponding to a region with amino acids YFEYKRDWDSIRLPGEDHRKELRWGVREQMLCRAEPQSKPQHIYVPNNYL
- Top Product
- Discover our top product HYLS1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HYLS1 Blocking Peptide, catalog no. 33R-10093, is also available for use as a blocking control in assays to test for specificity of this HYLS1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HYLS1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HYLS1 (Hydrolethalus Syndrome 1 (HYLS1))
- Andere Bezeichnung
- HYLS1 (HYLS1 Produkte)
- Synonyme
- HLS antikoerper, 3010015K02Rik antikoerper, HYLS1, centriolar and ciliogenesis associated antikoerper, HYLS1 antikoerper, Hyls1 antikoerper
- Hintergrund
- This protein is a protein localized to the cytoplasm. Mutations in this protein are associated with hydrolethalus syndrome.
- Molekulargewicht
- 34 kDa (MW of target protein)
-