IPP Antikörper (C-Term)
-
- Target Alle IPP Antikörper anzeigen
- IPP (Intracisternal A Particle-Promoted Polypeptide (IPP))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IPP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- IPP antibody was raised against the C terminal of IPP
- Aufreinigung
- Affinity purified
- Immunogen
- IPP antibody was raised using the C terminal of IPP corresponding to a region with amino acids EMQGLIYVIGGISNEGIELRSFEVYDPLSKRWSPLPPMGTRRAYLGVAAL
- Top Product
- Discover our top product IPP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
IPP Blocking Peptide, catalog no. 33R-2592, is also available for use as a blocking control in assays to test for specificity of this IPP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IPP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IPP (Intracisternal A Particle-Promoted Polypeptide (IPP))
- Andere Bezeichnung
- IPP (IPP Produkte)
- Hintergrund
- IPP is a member of the kelch family of proteins, which is characterized by a 50 amino acid repeat which interacts with actin.
- Molekulargewicht
- 65 kDa (MW of target protein)
-