Proline Rich 18 Antikörper (N-Term)

Produktnummer ABIN632970

Produktdetails anti-Proline Rich 18 Antikörper

Target: Proline Rich 18 (PRR18)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Proline Rich 18 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PRR18 antibody was raised against the N terminal of PRR18

Aufreinigung: Affinity purified

Immunogen: PRR18 antibody was raised using the N terminal of PRR18 corresponding to a region with amino acids RPPQRPEGLLSSSWPSATLKRPPARRGPGLDRTQPPAPPGVSPQALPSRA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRR18 Blocking Peptide, catalog no. 33R-8101, is also available for use as a blocking control in assays to test for specificity of this PRR18 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRR18 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Proline Rich 18

Target: Proline Rich 18 (PRR18)

Andere Bezeichnung: PRR18 (PRR18 Produkte)

Synonyme: 9630019K15Rik antikoerper, proline rich 18 antikoerper, PRR18 antikoerper, Prr18 antikoerper

Hintergrund: The function of PRR18 has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 31 kDa (MW of target protein)