Proline Rich 18 Antikörper (N-Term)
-
- Target Alle Proline Rich 18 (PRR18) Produkte
- Proline Rich 18 (PRR18)
-
Bindungsspezifität
- N-Term
- Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Proline Rich 18 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PRR18 antibody was raised against the N terminal of PRR18
- Aufreinigung
- Affinity purified
- Immunogen
- PRR18 antibody was raised using the N terminal of PRR18 corresponding to a region with amino acids RPPQRPEGLLSSSWPSATLKRPPARRGPGLDRTQPPAPPGVSPQALPSRA
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PRR18 Blocking Peptide, catalog no. 33R-8101, is also available for use as a blocking control in assays to test for specificity of this PRR18 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRR18 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Proline Rich 18 (PRR18)
- Andere Bezeichnung
- PRR18 (PRR18 Produkte)
- Synonyme
- 9630019K15Rik antikoerper, proline rich 18 antikoerper, PRR18 antikoerper, Prr18 antikoerper
- Hintergrund
- The function of PRR18 has not been widely studied, and is yet to be fully elucidated.
- Molekulargewicht
- 31 kDa (MW of target protein)
-