DIP2A Antikörper
-
- Target Alle DIP2A Antikörper anzeigen
- DIP2A (DIP2 Disco-Interacting Protein 2 Homolog A (DIP2A))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DIP2A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DIP2 A antibody was raised using a synthetic peptide corresponding to a region with amino acids PLKEFFVDDFEELLEVQQPDPNQPKPEGSETSVLRGEPLTAGVPRPPSLL
- Top Product
- Discover our top product DIP2A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DIP2A Blocking Peptide, catalog no. 33R-7196, is also available for use as a blocking control in assays to test for specificity of this DIP2A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DIP0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DIP2A (DIP2 Disco-Interacting Protein 2 Homolog A (DIP2A))
- Andere Bezeichnung
- DIP2A (DIP2A Produkte)
- Synonyme
- C21orf106 antikoerper, Dip2-like antikoerper, DIP2 antikoerper, 4931420H10Rik antikoerper, AI426328 antikoerper, Dip2 antikoerper, Kiaa0184-hp antikoerper, mKIAA0184 antikoerper, disco-interacting protein 2 homolog A antikoerper, disco interacting protein 2 homolog A antikoerper, Dip2a antikoerper, DIP2A antikoerper
- Hintergrund
- The protein encoded by this gene may be involved in axon patterning in the central nervous system. This gene is not highly expressed. Several transcript variants encoding different isoforms have been found for this gene.
- Molekulargewicht
- 170 kDa (MW of target protein)
- Pathways
- M Phase
-