RFESD Antikörper

Produktnummer ABIN632977

Produktdetails anti-RFESD Antikörper

Target: RFESD (Rieske (Fe-S) Domain Containing (RFESD))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RFESD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: RFESD antibody was raised using a synthetic peptide corresponding to a region with amino acids VVHDREVVIFYHKGEYHAMDIRCYHSGGPLHLGDIEDFDGRPCIVCPWHK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RFESD Blocking Peptide, catalog no. 33R-9881, is also available for use as a blocking control in assays to test for specificity of this RFESD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFESD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RFESD

Target: RFESD (Rieske (Fe-S) Domain Containing (RFESD))

Andere Bezeichnung: RFESD (RFESD Produkte)

Synonyme: MGC82457 antikoerper, zgc:112118 antikoerper, AI256775 antikoerper, D030068K09 antikoerper, RGD1308284 antikoerper, Rieske Fe-S domain containing antikoerper, Rieske (Fe-S) domain containing L homeolog antikoerper, Rieske (Fe-S) domain containing antikoerper, RFESD antikoerper, rfesd.L antikoerper, rfesd antikoerper, Rfesd antikoerper

Hintergrund: The function of RFESD protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 18 kDa (MW of target protein)