C15orf26/CFAP161 Antikörper (C-Term)

Produktnummer ABIN632983

Produktdetails anti-C15orf26/CFAP161 Antikörper

Target: C15orf26/CFAP161 (C15orf26) (Chromosome 15 Open Reading Frame 26 (C15orf26))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C15orf26/CFAP161 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C15 ORF26 antibody was raised against the C terminal Of C15 rf26

Aufreinigung: Affinity purified

Immunogen: C15 ORF26 antibody was raised using the C terminal Of C15 rf26 corresponding to a region with amino acids LINHCHTNRGLAAHRHLFLSTYFGKEAEVVAHTYLDSHRVEKPRNHWMLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C15ORF26 Blocking Peptide, catalog no. 33R-5056, is also available for use as a blocking control in assays to test for specificity of this C15ORF26 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF26 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C15orf26/CFAP161

Target: C15orf26/CFAP161 (C15orf26) (Chromosome 15 Open Reading Frame 26 (C15orf26))

Andere Bezeichnung: C15ORF26 (C15orf26 Produkte)

Synonyme: 1700026D08Rik antikoerper, AW047638 antikoerper, AW551802 antikoerper, C21H15orf26 antikoerper, cilia and flagella associated protein 161 antikoerper, cilia and flagella associated protein 161 L homeolog antikoerper, CFAP161 antikoerper, cfap161.L antikoerper, cfap161 antikoerper, Cfap161 antikoerper

Hintergrund: The function of C15orf26 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 34 kDa (MW of target protein)