ZNF420 Antikörper (N-Term)

Produktnummer ABIN632987

Produktdetails anti-ZNF420 Antikörper

Target: ZNF420 (Zinc Finger Protein 420 (ZNF420))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZNF420 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ZNF420 antibody was raised against the N terminal of ZNF420

Aufreinigung: Affinity purified

Immunogen: ZNF420 antibody was raised using the N terminal of ZNF420 corresponding to a region with amino acids LENYSNLVSLDLPSRCASKDLSPEKNTYETELSQWEMSDRLENCDLEESN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ZNF420 Blocking Peptide, catalog no. 33R-4917, is also available for use as a blocking control in assays to test for specificity of this ZNF420 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZNF420 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ZNF420

Target: ZNF420 (Zinc Finger Protein 420 (ZNF420))

Andere Bezeichnung: ZNF420 (ZNF420 Produkte)

Synonyme: APAK antikoerper, B230119D13 antikoerper, B230312I18Rik antikoerper, mszf59-1 antikoerper, mszf70 antikoerper, zinc finger protein 420 antikoerper, ZNF420 antikoerper, znf420 antikoerper, LOC713619 antikoerper, LOC100062389 antikoerper, LOC100346786 antikoerper, Zfp420 antikoerper

Hintergrund: ZNF420 contains 19 C2H2-type zinc fingers and 1 KRAB domain. ZNF420 may be involved in transcriptional regulation.

Molekulargewicht: 80 kDa (MW of target protein)