PIK3R5 Antikörper (N-Term)

Produktnummer ABIN632989

Produktdetails anti-PIK3R5 Antikörper

Target: PIK3R5 (Phosphoinositide-3-Kinase, Regulatory Subunit 5 (PIK3R5))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PIK3R5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PIK3 R5 antibody was raised against the N terminal of PIK3 5

Aufreinigung: Affinity purified

Immunogen: PIK3 R5 antibody was raised using the N terminal of PIK3 5 corresponding to a region with amino acids HRFLTWPVPYCSICQELLTFIDAELKAPGISYQRLVRAEQGLPIRSHRSS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PIK3R5 Blocking Peptide, catalog no. 33R-3839, is also available for use as a blocking control in assays to test for specificity of this PIK3R5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIK0 5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PIK3R5

Target: PIK3R5 (Phosphoinositide-3-Kinase, Regulatory Subunit 5 (PIK3R5))

Andere Bezeichnung: PIK3R5 (PIK3R5 Produkte)

Synonyme: F730038I15Rik antikoerper, FOAP-2 antikoerper, P101-PI3K antikoerper, p101 antikoerper, P101 antikoerper, RGD1563261 antikoerper, AV230647 antikoerper, phosphoinositide-3-kinase regulatory subunit 5 antikoerper, phosphoinositide-3-kinase regulatory subunit 5 S homeolog antikoerper, phosphoinositide-3-kinase, regulatory subunit 5 antikoerper, PIK3R5 antikoerper, pik3r5.S antikoerper, Pik3r5 antikoerper

Hintergrund: Receptor-regulated class I phosphoinositide 3-kinases (PI3Ks) phosphorylate the membrane lipid phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2) to PtdIns(3,4,5)P3, which in turn recruits and activates cytosolic effectors involved in proliferation, survival, or chemotaxis. PIK3R5 is a PI3K regulatory subunit.

Molekulargewicht: 97 kDa (MW of target protein)

Pathways: PI3K-Akt Signalweg, Inositol Metabolic Process, Hepatitis C, VEGF Signaling