EIF3L Antikörper (N-Term)
-
- Target Alle EIF3L Antikörper anzeigen
- EIF3L (Eukaryotic Translation Initiation Factor 3, Subunit L (EIF3L))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EIF3L Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- EIF3 EIP antibody was raised against the N terminal of EIF3 IP
- Aufreinigung
- Affinity purified
- Immunogen
- EIF3 EIP antibody was raised using the N terminal of EIF3 IP corresponding to a region with amino acids SYPADDYESEAAYDPYAYPSDYDMHTGDPKQDLAYERQYEQQTYQVIPEV
- Top Product
- Discover our top product EIF3L Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EIF3EIP Blocking Peptide, catalog no. 33R-8952, is also available for use as a blocking control in assays to test for specificity of this EIF3EIP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 IP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EIF3L (Eukaryotic Translation Initiation Factor 3, Subunit L (EIF3L))
- Andere Bezeichnung
- EIF3EIP (EIF3L Produkte)
- Synonyme
- wu:fb66c05 antikoerper, zgc:64147 antikoerper, EIF3EIP antikoerper, EIF3S11 antikoerper, EIF3S6IP antikoerper, HSPC021 antikoerper, HSPC025 antikoerper, MSTP005 antikoerper, 0610011H21Rik antikoerper, D15N1e antikoerper, Eif3eip antikoerper, Eif3ip antikoerper, Eif3s6ip antikoerper, HSP-66Y antikoerper, PAF67 antikoerper, eif3eip antikoerper, eif3s6ip antikoerper, eukaryotic translation initiation factor 3, subunit 6 interacting protein antikoerper, eukaryotic translation initiation factor 3 subunit L antikoerper, eukaryotic translation initiation factor 3, subunit L antikoerper, eukaryotic translation initiation factor 3 subunit L L homeolog antikoerper, eif3s6ip antikoerper, EIF3L antikoerper, Eif3l antikoerper, eif3l.L antikoerper
- Hintergrund
- EIF3EIP belongs to the EIF3EIP family. It interacts with EIF3E. EIF3EIP interacts with Int-6 and is associated with eukaryotic translation initiation factor 3.
- Molekulargewicht
- 67 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-