PRPS2 Antikörper (N-Term)
-
- Target Alle PRPS2 Antikörper anzeigen
- PRPS2 (phosphoribosyl Pyrophosphate Synthetase 2 (PRPS2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PRPS2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PRPS2 antibody was raised against the N terminal of PRPS2
- Aufreinigung
- Affinity purified
- Immunogen
- PRPS2 antibody was raised using the N terminal of PRPS2 corresponding to a region with amino acids PNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGE
- Top Product
- Discover our top product PRPS2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PRPS2 Blocking Peptide, catalog no. 33R-7234, is also available for use as a blocking control in assays to test for specificity of this PRPS2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPS2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRPS2 (phosphoribosyl Pyrophosphate Synthetase 2 (PRPS2))
- Andere Bezeichnung
- PRPS2 (PRPS2 Produkte)
- Synonyme
- prsii antikoerper, PRSII antikoerper, 2610101M19Rik antikoerper, AA589463 antikoerper, AI464149 antikoerper, Prps-2 antikoerper, phosphoribosyl pyrophosphate synthetase 2 L homeolog antikoerper, phosphoribosyl pyrophosphate synthetase 2 antikoerper, prps2.L antikoerper, PRPS2 antikoerper, Prps2 antikoerper
- Hintergrund
- PRPS2 is a phosphoribosyl pyrophosphate synthetase that plays a central role in the synthesis of purines and pyrimidines. The encoded protein catalyzes the synthesis of 5-phosphoribosyl 1-pyrophosphate from ATP and D-ribose 5-phosphate.
- Molekulargewicht
- 35 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process
-