SFRS12 Antikörper (N-Term)

Produktnummer ABIN633011

Produktdetails anti-SFRS12 Antikörper

Target: SFRS12 (SREK1) (Splicing Regulatory Glutamine/lysine-Rich Protein 1 (SREK1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SFRS12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SFRS12 antibody was raised against the N terminal of SFRS12

Aufreinigung: Affinity purified

Immunogen: SFRS12 antibody was raised using the N terminal of SFRS12 corresponding to a region with amino acids DPSSVGVAQHLTNTVFIDRALIVVPCAEGKIPEESKALSLLAPAPTMTSL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SFRS12 Blocking Peptide, catalog no. 33R-2117, is also available for use as a blocking control in assays to test for specificity of this SFRS12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SFRS12

Target: SFRS12 (SREK1) (Splicing Regulatory Glutamine/lysine-Rich Protein 1 (SREK1))

Andere Bezeichnung: SFRS12 (SREK1 Produkte)

Hintergrund: SFRS12 belongs to the superfamily of serine/arginine-rich (SR) splicing factors. It modulates splice site selection by regulating the activities of other SR proteins.

Molekulargewicht: 72 kDa (MW of target protein)